PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF003000030CFD_t1
Common NameTRAES_3BF003000030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 332aa    MW: 36924.5 Da    PI: 8.2252
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF003000030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42.1e-104686545
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45
                             k  rr+++NReAAr+sR+RKka++++Le+   +L++  ++L
  TRAES3BF003000030CFD_t1 46 KTMRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 86
                             7789************************9877777766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-842105IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.4964488IPR004827Basic-leucine zipper domain
PfamPF001702.0E-74686IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.2E-74689No hitNo description
Gene3DG3DSA:1.20.5.1708.4E-84791No hitNo description
PROSITE patternPS0003604964IPR004827Basic-leucine zipper domain
PfamPF141442.6E-34128203IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAEASPRTET STDDTDENLM LEPGNAALAV VSDSSDRSRD KNGDQKTMRR LAQNREAARK  60
SRLRKKAYVQ QLENSRLKLT QLEQELQRAR QQGIFISSSA DQSHSMSGNG ALAFDTEYAR  120
WLEEHNRQVN ELRAAVNAHA GDTELRSVVE KIMSHYDEIF KQKGNAAKAD VFHVLSGMWK  180
TPAERCFLWL GGFRPSELLK LLSTQLEPLT EQQLSGICNL QQSSQQAEDA LSQGMEALQQ  240
SLAETLAGSI GSSGSGSTGN VANYMGQMAM AMGKLGTLEN FLRQADNLRQ QTLQQMQRIL  300
TTRQSARALL VISDYSSRLR ALSSLWLARP KE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX567820.0X56782.1 T.aestivum 1b-c38 gene for HBP-1b (leucine zipper type transcription factor).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230791.10.0PREDICTED: transcription factor HBP-1b(c38)
SwissprotP239230.0HBP1B_WHEAT; Transcription factor HBP-1b(c38)
TrEMBLW5CVU10.0W5CVU1_WHEAT; Uncharacterized protein
STRINGBRADI2G10830.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48638185
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12250.21e-147TGACG motif-binding factor 6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]